DPCstruct | MC16826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1DVQ7 | 57-161 | AIGLIINMNYDAKDAAERQLRDRVVRPNDDGEHKRIVDDLKKAGVDFEFIEYLKGETHYIVVTITKASLLGLGALQADLPRERLLER… |
| A0A0R3WLD6 | 10-100 | FPRRALRCRLAIAITMNFINYGYVEEAHVEEISGVGSVFNQPYFAQISKTLGIELENLVYYKDETHYIVMTIKKRSLLNKGVLIENA… |
| A0A3P7BUX7 | 75-166 | None |
| A0A7S2NAN0 | 135-215 | None |
| A0A369SDG5 | 217-327 | None |
| A0A044QUV2 | 212-323 | None |
| A0A368FWB0 | 1-107 | None |
| A0A6I9PRD8 | 65-166 | None |
| A0A368F7R1 | 1-96 | None |
| H3B992 | 237-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.