DPCstruct | MC16825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 112 ± 30 aa |
| Standard deviation of domain lengths | 30.37 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4FJV6 | 2-70 | KKAGKLLHVTPSGGVVRFEVEPKMGQPVFDREGKRVGNVIDIFGPTQRPYVKIKPASGVRLEELVGKYV |
| A0A0R3WKZ5 | 17-110 | RGGRGTGSRSFEQEPLEAIELVGEVSHTCQRDLVCKLLNEGVPFFNAPIYLENKQEIGKVEEIFGPIKKSLFSVKLSDNLNTESFKE… |
| A0A504WUL3 | 435-530 | None |
| A0A146IC17 | 17-162 | None |
| A0A7C4E1Q6 | 9-80 | None |
| A0A2D8AU21 | 2-92 | None |
| A0A2D9M652 | 1-90 | None |
| R1BTF7 | 122-269 | None |
| A0A7J6KVE1 | 5-103 | None |
| A0A3M7HPQ6 | 115-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.