DPCstruct | MC16823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 431 ± 40 aa |
| Standard deviation of domain lengths | 40.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5LKK0 | 3-481 | YSLIDALLSAFKENDINYVHWKSNTNIDKALIGVDDLDILVAPADAQKINKIFSELAIIRAYSAKDAWQKDIYHYYGIDTNSAQLVH… |
| A0A4Y6QME8 | 2-435 | DIASELPGPEELGRLAASAEPKVPAEQQIHPKVRAVFDTLDGTGLPWLLLRGEDDLALPSGDVDILVDSDLLSRLDDILGSAGFCRV… |
| A0A7V3FHT5 | 34-471 | None |
| A0A537YGH7 | 35-471 | None |
| A0A2V9C4W0 | 17-480 | None |
| A0A1K1RVE4 | 392-824 | None |
| A0A2W4MM51 | 2-472 | None |
| A0A399WQM0 | 21-460 | None |
| A0A399YYU1 | 24-513 | None |
| A0A6L3F7X9 | 14-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.