DPCstruct | MC16821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 9.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K3ASI8 | 12-100 | LSHVSGAPCKMSPLTTFLTDAQQQTLHQLIVSARDSGANEEMVKESMDEYLAQILSPDRLQELKTAHDEFEAQRRGKRAAISASDKP… |
| A0A3P6HFQ0 | 1-111 | MSVRRRCPLSPFAQYLTDGEQEALHELIIEARQSGANEPEIKEHINRYLKEILSPEKLSQFEEANAKFERERFSKKLSKWYHTETDC… |
| A0A0N5AT42 | 93-195 | None |
| A0A0B2VNW0 | 80-185 | None |
| A0A4U5LXK8 | 78-186 | None |
| A0A183UW28 | 1-91 | None |
| A0A1I7XHN7 | 45-126 | None |
| H3F7R4 | 24-112 | None |
| A0A0N4U0N0 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.