DPCstruct | MC16820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 3.91 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 75.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158Q9J2 | 1-87 | MIKYYCYNIVPLPGREEMRRFFWKSVAEKNDIYNNRRVTLNERFSLIERGFKLSPIFSEEDPECCTFQVREVLLKETSMAKEKPVLR |
| A0A2G9UKN0 | 33-105 | NDVTYTIEPIEGRAAIQRNFVKLPERAPNYSNRHVTLNERFSIIERGYYLKPTELRQGSRPPRVVLVPTSTTS |
| A0A0N5CY67 | 2-74 | None |
| A0A0N4XSX2 | 1-77 | None |
| A0A7I4NNM5 | 1-76 | None |
| A0A2A2K488 | 1-74 | None |
| A0A1I8AKD4 | 1-78 | None |
| A0A4U8V249 | 96-171 | None |
| A0A498SAG9 | 19-97 | None |
| A0A7I4YFI7 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.