DPCstruct | MC16818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 120 ± 6 aa |
| Standard deviation of domain lengths | 5.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 55.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6T5A4 | 1-107 | MEVGANWYEGKYGYKSGWSVPLVQSLGVEGDTHAVVSVPVKQGELGKPIGVDVGGGVGPYYQQNQHVGVDYMNGQVGTNFGVGVPFT… |
| A0A2A2JRP7 | 138-259 | GGGFSSGVGVRDYWSQNMEAGANWVDGKYGYKNGWSVPLVQSLGVEGGQHNVVSFPLTGPRAHKLNVDNGYHVGSYFGINDHVGVDY… |
| A0A0N5D4A9 | 143-265 | None |
| E3MYA8 | 127-248 | None |
| A0A0R3PDP7 | 299-421 | None |
| A0A2G9TXU8 | 287-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.