DPCstruct | MC16817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 171 ± 31 aa |
| Standard deviation of domain lengths | 31.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.31 |
| Pfam Score | 97.87 |
| Assigned Pfam label(s) | CL0340- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8WM95 | 7-158 | FGRDILDDLARRVPYYISDYTDGLENAKTIQKVISTTFFLYFACILPAIAFGVLNDHNTHGKIDVKKVIIGQTIGGLAWVIFSGQPL… |
| A0A0N4VQU5 | 1-154 | MFGPGKWYPFRGLKEDFKRRLKYYASDYLDGLRGPKTIQKLFSTIVFLYFACLLPAIAFGVLNDDNTKGNIDVRKLIFAQGFGGIIW… |
| A0A1D6FM17 | 5-160 | None |
| A0A369JBZ2 | 33-211 | None |
| A0A6P7E636 | 243-454 | None |
| A0A0D2H9R5 | 27-172 | None |
| A0A7S4E7L8 | 25-200 | None |
| A0A4U0Y2F5 | 36-234 | None |
| A0A835YDN8 | 1-120 | None |
| B8BQU6 | 57-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.