DPCstruct | MC16816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 177 ± 51 aa |
| Standard deviation of domain lengths | 50.55 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1CPH1 | 2-104 | AFSMGLGTAFGGWRVIKTLGVNMLKLEPVHGFAAEASATSVILGASMLGLPVSTTHVISTCIMGVGATRRLSAVKWGIAGKIVLAWV… |
| A0A0N4VMS9 | 2-178 | GANDVSNAFGTSVGSKVLTLPKAYILATIFETLGAILVGYNVTDTMRKGVVDTQSFAKTPKTLLLGQVAILGGCSAWLIIATFARLP… |
| Q4UEK6 | 11-203 | None |
| A0A7R9AB15 | 29-258 | None |
| A0A6U6QK98 | 28-196 | None |
| A0A7S2UYL2 | 155-320 | None |
| M1V7V0 | 1-271 | None |
| A0A1Z5T2T3 | 7-204 | None |
| A0A7X8AA91 | 9-144 | None |
| A0A6A4NX51 | 144-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.