DPCstruct | MC16814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 157 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6EZ04 | 162-318 | EFVYIASACARMNLLDFFDKWGFLTPVDATIDDYGTGQLTVTQQMIDRIRSRVEALGYDAPTAAIEYITDNNYETFKQQKSVVKGTA… |
| A0A3S0QFT0 | 1-165 | MNFVKNTCDAVQEDLTDFFTNTGFLRPVDGTMDDYVSQQLTITQSMIDDVKSYVLSKGYAKPVSPVINYISANSVSTFKNLLPVSGI… |
| A0A1I6UC77 | 1-158 | None |
| A0A1M3MER5 | 583-728 | None |
| A0A6F9ZL47 | 723-886 | None |
| A0A5C6XXA4 | 17-161 | None |
| K1T2N4 | 93-257 | None |
| A0A359G524 | 828-997 | None |
| I9PPY2 | 722-869 | None |
| A0A0B7HJW0 | 341-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.