DPCstruct | MC16811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399SX39 | 381-487 | PATLRLERDKYCLLTDTEPILYEVSPADGTVAPNPAVDGVSVENGKIVILSDAFPATQIGVPIKFTVDNQVTDAVLTVYPGIKADFS… |
| A0A3S0N1V1 | 1-118 | MPSNVICSKAGAVPFTVLPVSGVVKASVTDNLNGGVELINGQYFFNPGMISPSLIGQEISFTVNGKPTSCSIKVVTQPDVTIDVVSV… |
| A0A2G1C3T1 | 67-209 | None |
| A0A7X6VXT0 | 510-611 | None |
| A0A4R1ACC4 | 567-671 | None |
| A0A1M6IVW7 | 844-958 | None |
| A0A4S3ZP92 | 718-836 | None |
| A0A316WS33 | 575-686 | None |
| A0A3D0YDQ2 | 629-756 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.