DPCstruct | MC16810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 234 ± 60 aa |
| Standard deviation of domain lengths | 59.90 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 76.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.09 |
| Pfam Score | 98.56 |
| Assigned Pfam label(s) | PF20235- PF03140- PF12274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q3H8U4 | 55-311 | SMPPVAGSTSRIISWEELAADREHDGDMDHKEEVASTMSLRRALLDKIHGYYLRALARLPAEYHRSMLHAGHCYGPMDPVSNIVLNT… |
| A0A0D3HAL7 | 9-170 | RRVVRPQTRYRPLSVEQDDERSRLLSNIQSFYHHASARHTAAAICVGLLDPVSNILANTLLSDEVAPPVDDADLARRSLDGLVAFLL… |
| T1NNQ5 | 5-259 | None |
| A0A0D9VNA6 | 25-289 | None |
| A0A368Q8X6 | 63-268 | None |
| A0A194YH41 | 368-573 | None |
| A0A368PIJ3 | 176-347 | None |
| A0A446IYQ8 | 55-309 | None |
| A0A811MFP8 | 173-391 | None |
| A0A3B6NNJ2 | 1-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.