DPCstruct | MC1681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 315 ± 85 aa |
| Standard deviation of domain lengths | 84.96 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 85.37 |
| Assigned Pfam label(s) | CL0010- CL0021- PF04981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4K4V1 | 34-353 | CPRCGQPATHGSFCKECLQAVHPLVVGIREGSVTMCASCPRVKVHSDWKDYDLEDALPRILGPCLQFASDAIIDCVDFDVPEGILRN… |
| A0A1J5T6R0 | 3-252 | ESVEHIFLHNLSWLKDSTNHNLSLSTKKFDETSYKIFAECSGSISEFTLSSKLEIDMLVKFQVCENCSRQAGGYFESTLQLRSKRKS… |
| A0A835H0D1 | 2-269 | None |
| A0A1Q9CAV7 | 9-201 | None |
| A0A2R4ZMR4 | 1-214 | None |
| A0A1V8SDU3 | 364-775 | None |
| A0A0V0QU82 | 23-386 | None |
| A0A812UT38 | 3-366 | None |
| A0A7S1GPJ2 | 2-368 | None |
| A0A7J6PIY8 | 6-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.