DPCstruct | MC16808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q3EDS1 | 14-82 | STSNATLTAEIESIMQKVVECGASEESPEYYMATKLFGKVENRVFFNTMKTKEGRLCWLTRMYEDRKRN |
| A0A0A9RUN8 | 46-130 | MVRQVTKLVEVISTGKSKNNLKIKEEIIALIEDVVQVGASEGSDEHYIASKLFVKQEYRAVWFSLKTNEGKMAWLKRMYDKRKKN |
| A0A0A9V4R5 | 162-223 | None |
| B6SLW5 | 1-83 | None |
| A0A287RRP2 | 74-161 | None |
| A0A0A9LUH0 | 1-89 | None |
| A0A2T7EQR5 | 161-256 | None |
| A0A811RIP8 | 252-342 | None |
| A0A270R818 | 104-195 | None |
| A0A3L6FH15 | 319-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.