DPCstruct | MC16803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 74 ± 2 aa |
| Standard deviation of domain lengths | 1.80 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 51.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2UYP5 | 39-112 | ITDPNPKWVTETMPLARVMGDMILLPNGKVLLINGAGSGSAGWELGQNPILSPVLYRPDKKIGSRFKTQNPTTI |
| A0A5P1FPN3 | 172-245 | ITDQSPSWSIETMPMARVMGDMLLLPTGHVIIVNGAGAGSAGWENAREPVLSPVIYNADGLVGDRFKVQSPSKI |
| A0A6A1UR90 | 526-598 | None |
| A0A6A2X0C3 | 262-335 | None |
| A0A7J0H2Z0 | 292-361 | None |
| A0A067FPY6 | 195-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.