DPCstruct | MC16802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.86 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2WUW4 | 78-153 | LVALLEAIAPNKDNVFVVAHNWGAIISWHLCLFRLDKVKALVNLSVHFLQRNPHMNLVEGFKTLYGEDHYIPRFQV |
| A0A445FKI1 | 107-175 | DSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKAYVCLSVPFLRRDPNIRTVDGMRALYGDDYYVCRFQK |
| A0A287EL38 | 4-71 | None |
| A0A6A2YDE7 | 1-67 | None |
| A0A830CIM6 | 86-162 | None |
| A0A2Z6MEL6 | 3-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.