DPCstruct | MC168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1C2K9 | 9-119 | LDRLAWVFMRVSGFFLVFLIFTHLIVNVMQDGGVHAIDFAFVAGKLADPMWQWFDVTLLWLAVLHGTNGMRTIVDDYVYRAKLKKVL… |
| A0A7C2V862 | 32-153 | RPQPPARPVGGVEFLGWAFMRVSGILLLFLVLGHFVIMHLMDGGVNRVNATFVAQRWANFGWRVYDFLMLALAMGHGVWGMRTVLLD… |
| A0A2E4D0W6 | 6-116 | None |
| A0A3A4P4F1 | 80-200 | None |
| A0A6L9J3I1 | 177-310 | None |
| A0A7Z8LAE6 | 2-115 | None |
| A0A4R4LNB4 | 7-118 | None |
| A0A7C2QKH1 | 10-133 | None |
| A0A212RU07 | 8-126 | None |
| A0A2H5WAY7 | 372-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.