DPCstruct | MC16799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 280 ± 60 aa |
| Standard deviation of domain lengths | 60.43 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 46.67 |
| Assigned Pfam label(s) | PF04829- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3ZQR1 | 35-326 | YKVSSSSASVSSSGMPSMPTSRNKSESERSTTHSAVSEGTIIIRNKDEQKQDINELSRDTEQANNELNHIFNKEKEQDIIEQTQLVS… |
| A0A348AH97 | 339-587 | GKTNSTYDSVTSQAGIFAGEEGFDIYVGKNTDLKGAVISSEAAPDKNRLSTGTLTYSDIENKASYSASSNGFSYNSKLEPGMTLGDL… |
| W3Y7U3 | 1-213 | None |
| A0A5E6NWK3 | 3-258 | None |
| A0A5E6NY88 | 494-760 | None |
| A0A5E6P0M7 | 1-277 | None |
| A0A380TSF6 | 93-427 | None |
| A0A1A7Q779 | 2-202 | None |
| A0A841KEA4 | 134-338 | None |
| A0A654RZ19 | 202-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.