DPCstruct | MC16789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 144 ± 19 aa |
| Standard deviation of domain lengths | 19.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4ZTS0 | 1-167 | MVTLPPGDFQPSGSAPGNDLIASLRVQDMTARYAHTTWVDAAGNTQPLSQNMVANLQDTLNGSPVLAEQVKLAASTVDPGSSPPRMH… |
| A0A1H3A5Q1 | 7-119 | DIGPLIDELARQKNLPPSAVADIEATIASSPYLANVMGAAIANGSLKHLGMTDEPHQSGHYDPGTGTVHLNRSNFDPARFDKAEVRQ… |
| A0A2T5LFV9 | 79-227 | None |
| A0A0S2FAZ5 | 2-121 | None |
| A0A7W5EQ27 | 79-246 | None |
| A0A6N4T001 | 9-130 | None |
| A0A836ZR69 | 1-136 | None |
| A0A0U5C007 | 96-245 | None |
| A0A7W8JNK9 | 1-133 | None |
| A0A1H7X536 | 10-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.