DPCstruct | MC16788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 207 ± 28 aa |
| Standard deviation of domain lengths | 27.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4XYV4 | 7-210 | NADAVAIIQSDFDLFDVASDQSRMDEGLPLNLVFDDRISQDDLRAVAYDTTGRYTPEQQAAAKRVLDNPELFRMLDTASGNSPTGDG… |
| A0A838C2G2 | 3-202 | PQSAAGALSSYMSQNGVDPITPNQLYQLSQNPPAGTPPDVSKAAQFMLQNPDVFKAIETHDVAGADGKAGIGDMQWAAQGGADGTQG… |
| A0A2G9C377 | 140-408 | None |
| A0A855QBX2 | 1-172 | None |
| A0A6I1LD80 | 102-347 | None |
| A0A328ZC73 | 29-229 | None |
| A0A328ZGY0 | 29-225 | None |
| A0A519EFC4 | 197-419 | None |
| A0A6J5F4K9 | 1-223 | None |
| A0A0S4UWW8 | 78-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.