DPCstruct | MC16783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5T688 | 170-330 | KDFAAALQSWSKARELAPSDFEIAKKVLQATNALGQRAAAVKAREAVFDLWRTSDDPEVRKLTEYVFDQFDVGTLHIFAFETFEPKG… |
| A0A518HDX2 | 21-195 | WGPEGDPRHLLPHVFARRALPDLLFHDPLVSLAMLGREDAGDTLRDFWDFVRERVDPGHDSPEPGPDAFSVRAFRLDGFVVALIRLP… |
| R9KB41 | 2-168 | None |
| A0A6N6Z7L3 | 32-216 | None |
| A0A6N6ZI99 | 17-188 | None |
| A0A559V8V4 | 2-150 | None |
| A0A354HYV0 | 32-184 | None |
| A0A3M1TN09 | 49-215 | None |
| A0A4V2G3T0 | 1-160 | None |
| A0A839INJ1 | 14-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.