DPCstruct | MC16781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518H1U7 | 58-150 | GQLWALGERGYTLFHTVVPPSSTQYPWRSCGFTCAGCSPEGSNFVNASSDHPGGANFALADGSVRFLKSTIDPLVYMALGTRKGGEV… |
| A0A518H5H5 | 525-608 | PGGRWADGNALYTRYHHVLPPGSPSCLLGGIEDYGSPVVSTASSRHPGGVNLLTGDGSVHFVKSTIDPEVWKAYGTVAGGEAVP |
| A0A7C4YHT3 | 10-105 | None |
| A0A5B9WFQ6 | 965-1042 | None |
| A0A6I6AK91 | 4-87 | None |
| A0A7D8UCI0 | 14-89 | None |
| A0A7V3VZ14 | 44-131 | None |
| A0A4P5YC92 | 40-123 | None |
| A0A432MJG5 | 182-274 | None |
| A0A7C6AYT3 | 21-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.