DPCstruct | MC16775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3YHE3 | 137-253 | SDSDNDGVGDNSDAFPNNPLETVDSDGDGVGDRADAFPDDESETMDSDGDGVGDNEQKAQEEKDAARMQLIIVIGVLVVLAGVGGVL… |
| A0A7M3SGI3 | 283-366 | LDSDQDGVNDAEDAFKFDANESVDTDNDGVADRWDAYPEDPTRSQAEVEESGNGLLYGVIVLLIVGLLGGGGYFYTRKPEMTVG |
| A0A4U1B458 | 412-488 | None |
| A0A6V8D3Z5 | 689-788 | None |
| A0A367IDM5 | 452-531 | None |
| A0A832XLS7 | 192-293 | None |
| A0A822XC51 | 36-133 | None |
| A0A1B1TFS2 | 609-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.