DPCstruct | MC16774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02971 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9JZ52 | 114-201 | NFNETPPHIAFEETRNQARKRGVRVSGSELVGLIPLESMIAAGKYFLTKQKRSTGIPVQDIIHIAVKSMGLDDLAPFDPNEKIIEYRI |
| A0A402EZV2 | 420-508 | DFETTPLHTVYEEVCRDAQDLNLPVVGSQLVGLVPKKAILDAAEFYINKNNLFILEEDHKIRLVVSRLGLDSLGPFNPKERIIEEMV… |
| A0A6A4W262 | 186-274 | None |
| A0A401SSL6 | 259-350 | None |
| A0A399XEM2 | 11-84 | None |
| A0A2Y9FZL4 | 199-287 | None |
| A0A7C7J7H3 | 69-155 | None |
| A0A226CSU2 | 2-92 | None |
| A0A847LX92 | 27-121 | None |
| A0A3P9J0F8 | 413-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.