DPCstruct | MC16772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 11.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U0PK37 | 176-301 | TVIVRDKEQLKAIPYSIYYKEELTDAAKLMREAAELTKDQTLKIFLSKRADSFLNDKYRDSEMAWMDLNGSLEIAIGPYETYTDKLF… |
| A0A292Q3X8 | 1-119 | MTALEGQKTEFSFSEVKKISVECRVAVEHSANEIQRKMWEEYAQSFDIGSIQRHKQSQKYWVQDKGPRVEANIGFIETYRDPAGVPA… |
| A0A354SM20 | 244-349 | None |
| A0A7R8CY54 | 127-260 | None |
| A0A534Q4Z2 | 190-304 | None |
| A0A2P7YVX3 | 30-159 | None |
| A0A6A5XYI0 | 93-198 | None |
| A0A4Y2LPP4 | 119-224 | None |
| W4PGF2 | 229-359 | None |
| A0A2P4VDZ9 | 250-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.