DPCstruct | MC1677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 163 ± 19 aa |
| Standard deviation of domain lengths | 18.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6NLC2 | 44-208 | TQIIDTSTPASNPNNFTTVPDLPSTTTVAGASNPQNQTFSSVSNAMDKLLSLKCPYIDSYGKKVVAFVKERKILINSNDPDDNKNKD… |
| A0A7J4I2P5 | 5-141 | SLVTLLMLLLSVLFLVGCSSSESKGQVYNSLDEVKALGKSMKCMWENPINKGTFWAFGEKSKTESLVGPTTFFLLDDGTYRYTWQSD… |
| A0A0G1SK68 | 2-131 | None |
| A0A5E4LB24 | 6-214 | None |
| A0A7J3DJF7 | 22-174 | None |
| A0A1F7JBA8 | 1-162 | None |
| A0A0G0KMJ1 | 36-204 | None |
| A0A7T9K0L7 | 44-218 | None |
| A0A516X4X0 | 1-144 | None |
| A0A349FV79 | 15-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.