DPCstruct | MC16767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08902 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2BDQ3 | 33-97 | QRKGCGCYESIDIGAYNTCPNGCIYCYANHSPKALEANLRQMDKNSEMLVGHVREGDKVTERRAV |
| A0A832WPL4 | 12-88 | KTPTRAGCWCYDSIDIGMYDTCLHDCVYCYANQDYRRALKRYRAHRPESPSLLPGEHQFNESKGSNRGSSLFCQPKL |
| A0A373VFM8 | 344-446 | None |
| A0A7C4HJS6 | 1-83 | None |
| A0A7C3QH35 | 199-256 | None |
| A0A3D2G7R4 | 19-113 | None |
| A0A1H4C8H8 | 213-301 | None |
| A0A3D0D343 | 429-499 | None |
| A0A1H7J6H5 | 62-157 | None |
| I3YQK1 | 155-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.