DPCstruct | MC16766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 225 ± 40 aa |
| Standard deviation of domain lengths | 40.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843KAS7 | 74-323 | ANINENKKLSIEYETRVHNKKFRFEDWGSFSVIGFLGEEYFAGYMDAPNTTDDILFEESKEKNLFSKMQLLRILIDNDDEMTITSGT… |
| A0A832TE16 | 50-302 | TIMSNDTAQAIKIYIGEERSPFAEFKDAESVSSADGSVKYYYMSDISEEIQTYEVGVPVTDIKGWDITFIDYEITPEKRALVQLKGP… |
| D5E9Z1 | 305-582 | None |
| A0A1V4YIV1 | 566-825 | None |
| A0A0E3SDC8 | 251-474 | None |
| A0A849QTF7 | 210-431 | None |
| A0A6A2FYZ2 | 668-853 | None |
| G7WM15 | 14-275 | None |
| A0A662RI85 | 205-372 | None |
| A0A2A2HPX5 | 8-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.