DPCstruct | MC16763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0LLZ5 | 35-165 | DSIFEDDWRNLIILDDCRYDIFKSEYIKRRLPGRLEYKISKGSWTGEFLLKNFTDKKYDDIIYITANPFVDKYLKGKFYKVISVWKN… |
| A0A662L0P4 | 5-149 | VKYVMEENWDFLIVLDACRYDYFNKFYRDFFNSGTLQKAISPGRETVEWCVKNFTEYYHDVIYISPIPFINSMKAVKYRGFYFDAKK… |
| A0A497RUF2 | 26-152 | None |
| B9LXB0 | 40-176 | None |
| U1NQI3 | 6-173 | None |
| A0A6A9SVU8 | 39-180 | None |
| A0A842KAC3 | 1-128 | None |
| A0A662H7I9 | 17-162 | None |
| A0A2R6T6T1 | 160-345 | None |
| G0QBW5 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.