DPCstruct | MC16762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 15.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662KXS3 | 5-159 | CKKYNVLRDEQGNTLVVDCKECDGECNLSSPKCFSGVFNIFVSEYPINSIVLSGFFERKYGSKACSILESLRDVVISLESMAESRTM… |
| A0A497TC10 | 1-151 | MVNYERVNDVLRIDCSKWVISPRIEDSAAAMAVVIDLLLKEKGIKKIILAEKRENEYSEEHVKLLYSIAETYDRIINKERLLNLNRI… |
| A0A2H9LA86 | 13-178 | None |
| A0A849Q5U1 | 19-179 | None |
| A0A6A0D097 | 4-172 | None |
| A0A0Q4B7A1 | 17-166 | None |
| A0A256ZKV6 | 6-173 | None |
| Q12ZQ6 | 1-142 | None |
| A0A133UIM0 | 3-129 | None |
| A0A5E4KUE4 | 71-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.