DPCstruct | MC16761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090MIM9 | 1-152 | MAHELGLFDSTTYVKHRKLRHSYDLTAWSLFHWQCTLSFQFQTAPLLQTPPQTPLPDPDLNADWYTQIWLKYPSTSVLVPMQCHYTF… |
| A0A420TAB1 | 46-212 | SMDQVGSLYLTRALEMSKALDLFGPTTHPGDPDLDKARVFTAWALYSWQALFNFSFFRPPLITKPPALSLPDAELSPEWYGEVWIQY… |
| A0A7J6JHG8 | 640-805 | None |
| A0A2K0UAP2 | 128-288 | None |
| Q2U5H5 | 64-235 | None |
| A0A2K0W7A4 | 29-179 | None |
| A0A5M9KQ84 | 1-173 | None |
| A0A166XIV1 | 695-863 | None |
| A0A0C4DJG2 | 2-124 | None |
| A0A084QS14 | 371-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.