DPCstruct | MC1676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 225 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843KJN1 | 2-185 | SLRYAHPKEVEGLIDRVGRRLGTPAQLEGFLFTHDTTDISSGPLESTYTKLKSMLEKLEAELELAGRIRAVDEDDVAERVLTTHFIR… |
| A0A7J4HY76 | 192-416 | MDSPLVLTSTLVPSEVDDQVHGIDVVWKYPLELYEAALEMKNPWEVRHGPDQKKIEQLADRLGTPAQYVGFGFTHHINNFNRGVQCS… |
| A0A7C5GJ67 | 285-553 | None |
| Q18ER3 | 2070-2284 | None |
| A0A7J2YGL1 | 384-603 | None |
| A0A7C2VNE7 | 602-818 | None |
| A0A7J4JDE2 | 746-982 | None |
| A0A842TJ82 | 296-545 | None |
| A0A1Q9PD80 | 57-272 | None |
| A0A843CJC6 | 576-794 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.