DPCstruct | MC16758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 145 ± 28 aa |
| Standard deviation of domain lengths | 27.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4LTS8 | 21-169 | IPAAVPTAPYPPSPVESQYFYYGIPSHPRLVARSSFNVWVKPTGPEAYLLPKESTPIGLHPLREIWETTVGPDMVGYLDSKGVKWTS… |
| A0A090MBU3 | 12-151 | EEERHGYFRGLPSRPILIARTSTDPWVMHENFHCVYKTLSVVRKHAITDMWDTGPLCRDIMECLENVEMIGVDILRLGYEHLSKLDE… |
| A0A0C3BWD6 | 19-228 | None |
| A0A2V5I714 | 47-191 | None |
| A0A1L9VTX6 | 93-202 | None |
| A0A1L9TCL7 | 33-188 | None |
| A0A1V6SDQ0 | 45-187 | None |
| G4T5H6 | 71-225 | None |
| A0A4R0S460 | 336-467 | None |
| A0A1B8EW01 | 18-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.