DPCstruct | MC16756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 204 ± 22 aa |
| Standard deviation of domain lengths | 21.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A505IUW8 | 2-207 | KKSFKLLLSLGGVSAVAFMPLVAASCAKKEEPKKPEQPVNPAQPATPAQPATPAQPAADPNKELVTAINTKLKEIAVPENFTWAPAA… |
| Q9RPL1 | 1-231 | MKKFKKNLSLLTVSILGTTLFATSVVAAACDDTKKKPEEPKKEDPKQKPDQKQEQGQEITELNNWLKSMSLKIVDGKIDAFYKAIEA… |
| D1J821 | 1-236 | None |
| A0A3M0A7Q9 | 1-206 | None |
| A0A857DDI4 | 483-645 | None |
| A0A809RTN8 | 1-188 | None |
| A0A2Z4LLP7 | 111-303 | None |
| A0A168RL78 | 46-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.