DPCstruct | MC16753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 214 ± 49 aa |
| Standard deviation of domain lengths | 49.24 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 68.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5B4T5 | 43-318 | YGPLRPFQDSVPAAPLPAPFQPPPGPPLPPRVSPQWTGPYSPAVSSPPPSFPFWNGSNLTPQQTGYRDPYVQPQNGASPYAPPTSAP… |
| A0A3G2S2G7 | 23-171 | GDASSHHEAAAPSLPPRPRPPSPSSTAPAPPRPVGPLPTASPANGYPLLYKGKILLYPATVPTCTKCYETGYVNRNPLKPCKSCWHR… |
| A0A376B2J1 | 1-244 | None |
| A0A0D7B2T6 | 35-214 | None |
| J4HWP7 | 171-345 | None |
| A0A0F7SK05 | 229-470 | None |
| A0A316YYF7 | 4-235 | None |
| A0A1M8A5P8 | 1-284 | None |
| A0A511KAH0 | 1-153 | None |
| A0A0C2WC35 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.