DPCstruct | MC1675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4KY33 | 1-89 | MNIDSIENGYVIDHIPAGKGMQIYNVLSLDKLNCQVAIITNAKSQKNDVKDIIKINELVELDLDIIAFIAPEATVNVIKDSQRIDKK… |
| A0A7J3RD19 | 1-123 | MPKKGVSVQGNVQEGYWIHSGIVVEEIKNGTVVDHISAGDGLSLYIELTQKIQAQAQNPESLESVLLQNVKSKKHGRKDIIKITEFY… |
| A0A2R6EXE4 | 2-95 | None |
| A0A842WAI2 | 23-119 | None |
| A0A256ZU03 | 1-96 | None |
| A0A644X9J2 | 99-213 | None |
| A0A5E4JN81 | 114-229 | None |
| A0A7C5CN75 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.