DPCstruct | MC16748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 205 ± 32 aa |
| Standard deviation of domain lengths | 31.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7U912 | 194-420 | AYSTIIHVNDIDPIRNCIPEIIPLHLDINNHQLQCQLKINEFKCELVMNLTEDKIWSLITDNEIRVRADKSENDIIEKSLEEILNEY… |
| C0ZUB6 | 11-203 | VCVWDGLTYPGIDCSLRSPKFLKAVPPLWQVPLSGLFATIESAHPVFEAISDEATTSSRGHSVRLSVWLNKNKQTLFLAGDRMIDGD… |
| A0A1E3VK59 | 417-631 | None |
| A0A0U2WAT3 | 31-270 | None |
| A0A1X7LJF9 | 160-358 | None |
| A0A2K1NVC3 | 3-224 | None |
| A0A2S5AKQ1 | 4-195 | None |
| A0A372FPX5 | 9-224 | None |
| I4EKM3 | 2-166 | None |
| A0A4P6LZE8 | 3-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.