DPCstruct | MC16747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U1AQ13 | 5-156 | AYKDFKNNTSNAYLNFIQLCKKKAKQYTALELTKCQVHHIVPRHHFQTHNLDLKNLDIPENLVVLSFNDHIEAHKIRFNVYNEYADK… |
| D0FY11 | 40-208 | KFPNLQDLLNDKNKGIDIYSVFLKKATERAKKAIKENSNTYTEVHHIIPRHAGGSDDKENLTVLLYNDHVLAHYVRWAQYNEPGDKI… |
| B3V4Q9 | 9-157 | None |
| A0A0S2IC39 | 33-160 | None |
| A0A0S2IBQ5 | 68-228 | None |
| A0A1W5RMW3 | 22-176 | None |
| A0A4Q3EPI1 | 8-158 | None |
| A0A1C9JBB1 | 1-144 | None |
| B3V4R3 | 22-147 | None |
| A0A249RWV3 | 12-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.