DPCstruct | MC16742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 370 ± 70 aa |
| Standard deviation of domain lengths | 70.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0282 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7PWY9 | 106-550 | DTYGDMADCCTKKEPERHECFLKHKDDNPNLPALVRPEPDALCTAFKESDQKLLGSYLYEVARRHPFFYGPELLYSIQEYKGVLTEC… |
| A0A2K5VX17 | 27-361 | FFVSFSSYPPFTSLVYIHCFPVSSLALLLSLFHFLNSFLYEVARRNPFVFAPTLLTVAAHFEEVAKSCCEEQNKVNCFQTRAIPVIQ… |
| A0A7J8JPS8 | 14-355 | None |
| H2ZZM2 | 18-370 | None |
| A0A668A0J5 | 73-468 | None |
| G3UIJ9 | 52-543 | None |
| A0A4U1ENC7 | 6-339 | None |
| A0A3L8S409 | 19-333 | None |
| A0A670YYJ5 | 23-315 | None |
| A0A803J2H6 | 2-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.