DPCstruct | MC16741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 168 ± 29 aa |
| Standard deviation of domain lengths | 28.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q10063 | 287-453 | ACQLIYDLQFCSEVAYAVPGNSSLFSASALAEWYDQQAYGYYQNFTYTLDLIPCNATSWSAYSLLKNCSDCANSYKNWLCASVIPRC… |
| A0A4Q2DW76 | 12-194 | IYTGDTLPEALSDPLRSYLTNFTVTLNTFACGRDFYSPLVSCLDCQVEYRKWLCAVSLPRCSEPSPANPSGVTAVPAAPTVTGLSAT… |
| A0A0A2IU22 | 405-576 | None |
| A0A177U639 | 408-614 | None |
| A0A146I5I3 | 796-965 | None |
| A0A2R6WV91 | 173-314 | None |
| M5FX64 | 3-140 | None |
| A0A093XN23 | 228-378 | None |
| A0A830HGY2 | 83-231 | None |
| A0A2N1NF68 | 216-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.