DPCstruct | MC1674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 171 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0VGS0 | 2-109 | IRGCAVGMLAGALVGVAQGWPTVGVVQGVGAILGDLMSSFVKRRLDLEPGASAPLLDQLDFIVVAALLSQPLTKASHQDLATIILLT… |
| A0A7J3LM16 | 157-333 | TALYYASPGLISNMIPVFVRRIRFLDIPVDLGKSWRGKRIFGSHKTYRGFFFAILFAIFLVYIQTLLYDVHFFWTISYINYANLGAH… |
| A0A2N2F2N7 | 10-180 | None |
| A0A396ABG8 | 25-216 | None |
| A0A7J3NPP3 | 1-226 | None |
| A0A7C1B0U7 | 2-139 | None |
| A0A832V4L1 | 9-171 | None |
| A0A2H0QPV5 | 2-178 | None |
| A0A661BQS9 | 2-148 | None |
| A0A2W4SM76 | 11-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.