DPCstruct | MC16738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 47 ± 4 aa |
| Standard deviation of domain lengths | 3.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9H6Q8 | 1-45 | MTPMEVCEGLGLFDLKNRKWHIQGTCALRGDGLYEGLDWLAGTLK |
| A0A444UVV9 | 110-156 | MNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK |
| A0A820IC92 | 8-57 | None |
| A0A7J9K9A3 | 1-50 | None |
| A0A433QV77 | 1-43 | None |
| A0A3N0YMG6 | 71-117 | None |
| A0A444DW48 | 2-42 | None |
| A0A672S4L3 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.