DPCstruct | MC16735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 77 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830C6B6 | 1-51 | MKESHVLQFSKDEEALIVRMYNLVGKRWTLIAGRIPGRTAEEIEKYWESRY |
| A0A7J8NQ51 | 108-176 | KQPKTSGCCSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDKWALIAGRIPGRKAEEIERFWIMRHGEGF |
| A0A834TKR8 | 2-71 | None |
| A0A3S3QGJ9 | 1-96 | None |
| A0A830C6J0 | 2-81 | None |
| A0A5A7R5L4 | 1-80 | None |
| A0A7J7H9L0 | 90-157 | None |
| A0A067JQA7 | 2-75 | None |
| A0A3S3MRD1 | 1-84 | None |
| A0A2H9ZTV1 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.