DPCstruct | MC1673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 65 ± 3 aa |
| Standard deviation of domain lengths | 3.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4JP57 | 1-66 | MKKSILDWIALILVIIGGLNWGLVAINPSYDVVAMIGGGMTGMIARIIYALVGLAALYAIYYLFKE |
| A0A7J3LKX2 | 1-63 | MKKSVLDWVALILVIVGGLNWGLVGLFKFDLVATLFGAMSMLSRIVYSLVGIAAVYLIYFAVK |
| A0A1G3A1L6 | 7-75 | None |
| A0A2N8K316 | 1-68 | None |
| A0A0N7LVQ9 | 1-68 | None |
| A0A839LRG2 | 1-65 | None |
| A0A7V9SGU1 | 6-71 | None |
| A0A2N7RN43 | 76-136 | None |
| A0A5C0B8X1 | 6-68 | None |
| A0A317JQL4 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.