DPCstruct | MC16728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 87 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.15 |
| Pfam Score | 94.59 |
| Assigned Pfam label(s) | CL0063- CL0115- CL0506 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7V7I0 | 15-93 | YTSTRQNLKIGKNTKVLIQGFTGKQGTFHGQQMIEYGTNVVGGVSPSKAGTQHLGKPIFATAKEAKDATGADASVIYVP |
| A0A559MM86 | 11-103 | LMQAAVRRQGYSTASAAYTSTAENLRITKDTKVIYQGFTGKQGSFHAEQAIAYGTQVVGGTNPKKAGQTHLGLPVFANVADAVRQAG… |
| A0A0B0IB99 | 1-86 | None |
| A0A090S9Z3 | 1-73 | None |
| A0A7C8PXK1 | 1-104 | None |
| U6MZN9 | 61-171 | None |
| A0A669BQL9 | 14-99 | None |
| A0A401RP89 | 12-92 | None |
| A0A2T3ACJ3 | 38-121 | None |
| A0A535PPD3 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.