DPCstruct | MC16727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3G7T5 | 130-255 | LIDCATFSSLVEIRVAPGRVMGLFLTKDVSAGDLNLCGKAFSYYFMDDEKSHETYPILLNMSSKELTSGGSVHLWPQVTQKLFHNPE… |
| A0A559MHY7 | 1-122 | MYRYAKLGPVDFATYDNPVEVRQVEGKGRGLFTNKSVKCGELLACEKAFSYVCSPETSAAFGALINLTTNRVKIGTDAAHISNVYQK… |
| Q2GXJ7 | 222-348 | None |
| A0A5C6SVT1 | 185-295 | None |
| F9X6C9 | 203-310 | None |
| A0A317X8P1 | 255-368 | None |
| A0A420PKI8 | 241-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.