DPCstruct | MC16726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 180 ± 32 aa |
| Standard deviation of domain lengths | 31.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05241 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S9C4C0 | 29-223 | SLLGSFVAGCIAIFGLTYLAVKKVNPRLPTSELLTVMWFVLCGCIHLFFEGYFAYNNANLGGLQTFFGQLWKEYALSDSRYLTQNTF… |
| A0A559M8Z0 | 13-175 | LTTQKAFSCPGGTIHLFFEGYFMYNHSRMGSRMDLFGQLWKEYALSDSRYMHSDPFVLCMETWTAITWGPLSFLTAVLITKDSPYRH… |
| A0A0B7NI55 | 13-166 | None |
| A0A109FJS9 | 13-178 | None |
| A0A4Y1QPI4 | 240-431 | None |
| A0A1E5V499 | 67-249 | None |
| A0A178A7Q0 | 10-152 | None |
| A0A7J7IG44 | 3-127 | None |
| F1QDW6 | 63-246 | None |
| A0A395IRR6 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.