DPCstruct | MC16725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 231 ± 32 aa |
| Standard deviation of domain lengths | 31.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559M8L3 | 28-274 | AVPFVLHSQPTGVFETRSNSVKMMAAEAHRRYWEIMRDVEVMIDDHIAHQEVGLHGQSKLKLLVPSIGTFFTKLPLADAFIYQDKKR… |
| A0A024WG46 | 66-210 | LVEIFRSLFVSNCIDKNIDNVLLSIEEMFIDHYYNPQHSRLKYLIDDVGIFFTKLPITKAFHTYNKKYRITKRLYAPPTFNEVRHIL… |
| A0A0E9NM15 | 362-626 | None |
| A0A4U0X708 | 10-204 | None |
| C1MU32 | 180-437 | None |
| A0A388KNT3 | 390-643 | None |
| A0A194WA85 | 1-262 | None |
| A0A3R6XH10 | 3-191 | None |
| A0A5D6Y8R8 | 98-317 | None |
| A0A421JAB5 | 1-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.