DPCstruct | MC16724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447BZT6 | 1-100 | MSHTAPPTIISLKTNFLSAQTRALSNPLHPSRAWQTTNEELPDKAVNDVMAKLNNRVLQHCKRVYAPQATRHVAEQIEALYISSSYE… |
| A0A559M7A8 | 1-117 | MTSNTPTIIDLKTAFLRTQIQALSQPLRAPSSLPETDDNAPPRQRNIDDALQKLNAQVKKHNRLVYGPQAMRHVAEQVDRFYWNAGE… |
| A0A0G2H495 | 1-119 | None |
| A0A420IIY0 | 1-118 | None |
| A0A6G1GBZ5 | 1-117 | None |
| A0A164ZWX8 | 1-116 | None |
| A0A6C1LTG3 | 1-121 | None |
| A0A1W5D0N8 | 1-109 | None |
| A0A0U1M3U4 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.