DPCstruct | MC16722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 19.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 46.97 |
| Assigned Pfam label(s) | PF19794- PF12713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2P2P2 | 1-92 | DDSALSLEQLDQVLPRWRGDEEIQTWLGNDAGLYLGTVIVRTVPGAAWSIRSDGQPVVRLASGREFDVVANGHAWAEDGVPELSQLY… |
| A0A7S9UMF5 | 19-162 | ALAANKPKPDFVADPAVQRAATAYAAQAVATARDQFGIKLDGTDASMVQLEAVLARAHTSYAAKSPRPSDEQVMAVARMYGSYLGEV… |
| A0A6A9SZU6 | 41-185 | None |
| A0A6A9T1Y5 | 138-332 | None |
| A0A418M3T8 | 138-281 | None |
| D7BLY7 | 3-129 | None |
| A0A0Q7XGV8 | 98-231 | None |
| Q1AWL5 | 134-260 | None |
| A0A7Y4ZP74 | 62-181 | None |
| A0A1W1Y059 | 4-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.