DPCstruct | MC1672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9YIB8 | 2-102 | VGCCSVEYVGRARSTLGWGERIVIVKPDGSVLVHQRVGREPVNWQPPDTRVRYQTETDDGTALFVIYSYRFKPPEKMYVRFKNIETI… |
| A0A7J3XZY5 | 27-127 | KDTLIIVGECEVEYEGRGYTRLASGERIVLVKSDGSVIVHRPYGFQPVNYQPDTDSIESWIEPDGRLSIIAVRDKPREALKITFSRI… |
| A0A1F1AY89 | 1-116 | None |
| A0A497PRX2 | 31-124 | None |
| A0A1J1AAA3 | 6-97 | None |
| A0A2Z2HYW8 | 21-137 | None |
| A0A3P3R5U1 | 4-95 | None |
| A0A256Z1D8 | 9-110 | None |
| A0A1H5NE53 | 1-111 | None |
| A0A7J9PZ33 | 58-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.